Immunosupressant peptides

Immunogen Antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human MYBPC1. Features and Benefits Evaluate our antibodies with complete peace of mind.

General description Anti-MYBPC3 Antibody detects endogenous levels of total MYBPC3 protein. Immunogen The antiserum was produced against synthesized peptide derived from human MYBPC3.

Immunogen Synthetic peptide directed towards the middle region of human MYCL1 Biochem/physiol Actions The MYCL1 gene encodes a protein which is associated with lung cancer in idiopathic pulmoary fibrosis. Sequence Synthetic peptide located

Immunogen Synthetic peptide directed towards the N terminal region of human MYD88 Sequence Synthetic peptide located within the following region: YLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP Physical form Purified antibody supplied in

Immunogen Peptide with sequence C-IKYKAMKKEFP from the internal region of the protein sequence according to NP_002459.1.

Specificity This antibody reacts to human myeloid differentiation primary response protein MyD88. Immunogen A peptide corresponding to the N-terminus of human MyD88.

Immunogen a peptide corresponding to amino acids 279-296 of human MyD88, which is identical to mouse. Linkage The action of this antibody can be blocked using blocking peptide SBP2127 .

Immunogen Synthetic peptide directed towards the middle region of human MYD88 Sequence Synthetic peptide located within the following region: TCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKR Physical form Purified antibody supplied in 1x

General description The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated

Immunogen Peptide with sequence C-DHSRSTKAVSEK from the internal region (near the C Terminus) of the protein sequence according to NP_000521.1.

Immunogen Peptide with sequence SYRPKQENLEGAD, from the internal region of the protein sequence according to NP_002460.1 Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Synthetic peptide directed towards the N terminal region of human MYH10 Biochem/physiol Actions MYH10 is the cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and