Immunosupressant peptides

Immunogen Synthetic peptide directed towards the middle region of human MYH7 Biochem/physiol Actions Myh7 play a role in muscle contraction. Sequence Synthetic peptide located within the following region:

Immunogen Synthetic peptide directed towards the middle region of human MYL6 Sequence Synthetic peptide located within the following region: PMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMT Physical form Purified antibody supplied in 1x PBS

Immunogen Peptide with sequence C-KDTKNMEAKKLSKD, from the internal region of the protein sequence according to NP_444253.3: NP_444254.

Immunogen Peptide with sequence C-RTVEAKQEKVSTT, from the internal region of the protein sequence according toNP_001123630.1: NP_036355.

Immunogen Peptide with sequence C-KDLMEPALESAVMY from the C Terminus of the protein sequence according to NP_056275.2.

General description This gene encodes a classical cadherin and member of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein is proteolytically processed to generate

General description This gene encodes a classical cadherin and member of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein is proteolytically processed to generate

General description This gene encodes a classical cadherin and member of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein is proteolytically processed to generate

Immunogen Antibody was raised against a 18 amino acid synthetic peptide near the amino terminus of human N4BP1. Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Synthetic peptide of human NANOG Features and Benefits Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody.

Immunogen Peptide with sequence C-QNQRMKSKRWQKNN from the internal region of the protein sequence according to NP_079141.1.

Immunogen a 17 amino acid peptide from near the amino-terminus of human Nanos1. Linkage The action of this antibody can be blocked using blocking peptide SBP4683 .