Immunosupressant peptides

Immunogen a 16 amino acid peptide near the carboxy-terminus of the human Nanos3. Linkage The action of this antibody can be blocked using blocking peptide SBP4653 .

Immunogen Peptide with sequence C-KSDKKRKLEAKQ, from the internal region of the protein sequence according toNP_078938.1 Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen NAT11 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human NAT11. Features and Benefits Evaluate our antibodies with complete peace of mind.

General description NDNF promotes matrix assembly and cell adhesiveness. It promotes neuron migration, growth and survival as well as neurite outgrowth.

General description NDNF promotes matrix assembly and cell adhesiveness. It promotes neuron migration, growth and survival as well as neurite outgrowth.

Specificity The antibody detects endogenous levels of total NDNL2 protein. Immunogen Synthetic peptide corresponding to residues near the C terminal of human necdin-like 2 Features and Benefits Evaluate our antibodies with complete peace of

Immunogen The immunogen for anti-NDUFA6 antibody: synthetic peptide derected towards the C terminal of human NDUFA6 Sequence Synthetic peptide located within the following region: VVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHD Physical

Immunogen A synthesized peptide derived from human NDUFB8 Physical form Buffer: PBS with 0.02% sodium azide,0.

Immunogen Synthetic peptide directed towards the middle region of human NDUFC1 Sequence Synthetic peptide located within the following region: RSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGL Physical form Purified antibody supplied in 1x

Immunogen Peptide with sequence CDTRPTVRPRNDVAHK, from the internal region of the protein sequence according to NP_004542.1.

Immunogen synthetic peptide corresponding to amino acids 106-120 of human NEIL2 Physical form Solution in 0.01 M phosphate buffered saline, pH 7.

Immunogen Peptide with sequence CINPDPEKRPDVT, from the C-terminal region of the protein sequence according to NP_598001.1 Features and Benefits Evaluate our antibodies with complete peace of mind.