Immunosupressant peptides

Immunogen Synthetic peptide directed towards the C terminal region of human NFKBID Sequence Synthetic peptide located within the following region: QARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELP Physical form Purified antibody supplied in

General description Anti-NFYC Antibody detects endogenous levels of total NFYC protein. Immunogen The antiserum was produced against synthesized peptide derived from human NFYC.

Immunogen Synthetic peptide directed towards the N terminal region of human NGRN Sequence Synthetic peptide located within the following region: MAVTLSLLLGGRVCAAVTRCGFATRGVAGPGPIGREPDPDSDWEPEEREL Physical form Purified antibody supplied in 1x

Immunogen synthetic peptide (Asp-Gln-Lys-Arg-Tyr-His-Glu-Asp-Ile-Phe-Gly), derived from amino acids 1113-1122 with N-terminally added Asp, of mouse iNOS and nNOS. The immunogen sequence is highly conserved among the various NOS isoforms.

Immunogen Synthetic peptide directed towards the middle region of human NKAIN1 Biochem/physiol Actions It belongs to the NKAIN family. Sequence Synthetic peptide located within the following region:

Immunogen Synthetic peptide directed towards the middle region of human NKIRAS2 Application Anti-NKIRAS2 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1&#956g/mL. Biochem/physiol Actions NKIRAS2 (NFKB

Immunogen Synthetic peptide directed towards the middle region of mouse Nkx1-2 Biochem/physiol Actions Nkx1-2 may function in cell specification, particularly in the CNS. Sequence Synthetic peptide located within the following region:

Immunogen Synthetic peptide directed towards the c terminal region of mouse Nkx2-3 Biochem/physiol Actions Nkx2-3 is a transcriptional regulator essential for normal development and functions of the small intestine and spleen.Nkx2-3 activates

Immunogen Synthetic peptide directed towards the N terminal of human Nkx2-6 Sequence Synthetic peptide located within the following region: MGSNPVGEPQTPPGTISRLGARNPMTDRGVGNLSGDMRRGGPVSTRTRPQ Physical form Purified antibody supplied in 1x PBS

Immunogen Peptide with sequence C-TEKHHPWAERPSSHD, from the C-terminal region of the protein sequence according toNP_060322.1 Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Peptide with sequence KNPQLIIDTEKHHP, from the near the C-terminal region of the protein sequence according to NP_060322.1 Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Peptide with sequence C-TQERVNNSNKKE from the internal region of the protein sequence according to NP_000823.4: NP_067544.