-
Add to Cart The item has been addedSAB2104898-100ULANTI-NME4 (C15-1744-481)
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the middle region of human NME4 Sequence Synthetic peptide located within the following region: VAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSV Physical form Purified antibody supplied in 1x PBS -
Add to Cart The item has been addedSAB2500700-100UGANTI-NOGO 66 RECEPTOR ANTIBODY PRODUCED IN GOAT
Price: $1,062.79List Price: $1,180.87Immunogen Peptide with sequence C-LQALPDDTFRDLGN from the internal region of the protein sequence according to NP_075380.1. -
Add to Cart The item has been addedSAB2500701-100UGANTI-NONO/P54NRB ANTIBODY PRODUCED IN GOAT
Price: $1,062.79List Price: $1,180.87Immunogen Peptide with sequence C-NRAAPGAEFAPNK from the C Terminus of the protein sequence according to NP_031389.3. -
Add to Cart The item has been addedMAB5620ANTI-NOREPINEPHRINE TRANSPORTER ANTIBODY
Price: $1,078.09List Price: $1,197.88Specificity Norepinephrine Transporter, human and non-human primate. Immunogen Synthetic peptide from human norepinephrine Transporter. -
Add to Cart The item has been addedSAB2501641-100UGANTI-NOX5 ANTIBODY PRODUCED IN GOAT
Price: $1,062.79List Price: $1,180.87Immunogen Peptide with sequence EWHPFTISSAPEQKD, from the internal region of the protein sequence according to NP_078781.3: NP_001171708. -
Add to Cart The item has been addedSAB2105279-100ULANTI-NPAS2 (C15-1744-412)
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the middle region of human Npas2 Biochem/physiol Actions BMAL1-NPAS2 heterodimers activate E-box element (3′:-CACGTG-5′:) transcription of a number of proteins of the circadian clock. This -
Add to Cart The item has been addedSAB3500962-100UGANTI-NPAS3 ANTIBODY PRODUCED IN RABBIT
Price: $963.62List Price: $1,070.69Immunogen Antibody was raised against a 28 amino acid synthetic peptide from near the center of human NPAS3. Features and Benefits Evaluate our antibodies with complete peace of mind. -
Add to Cart The item has been addedSAB3500300-100UGANTI-NPC1 ANTIBODY PRODUCED IN RABBIT (C15-1741-221)
Price: $987.94List Price: $1,097.71Immunogen NPC1 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human NPC1. Features and Benefits Evaluate our antibodies with complete peace of mind. -
Add to Cart The item has been addedSAB2104055-100ULANTI-NPHP1 (C15-1744-655)
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the middle region of human NPHP1 Sequence Synthetic peptide located within the following region: GILFELGISYIRNSTGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGG Physical form Purified antibody supplied in 1x -
Add to Cart The item has been addedSAB2101624-100ULANTI-NPM2 (C15-1745-179)
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the N terminal region of human NPM2 Sequence Synthetic peptide located within the following region: LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQA Physical form Purified antibody supplied in 1x -
Add to Cart The item has been addedSAB2501837-100UGANTI-NPPA (C-TERMINAL) ANTIBODY PRODUCED IN GOAT
Price: $1,062.79List Price: $1,180.87Immunogen Peptide with sequence RIGAQSGLGCNSFR, from the C-terminal region of the protein sequence according toNP_006163.1 Features and Benefits Evaluate our antibodies with complete peace of mind. -
Add to Cart The item has been addedSAB2501813-100UGANTI-NPRL3 ANTIBODY PRODUCED IN GOAT
Price: $1,062.79List Price: $1,180.87Immunogen Peptide with sequence C-QRSQEHPASQTNKP, from the internal region of the protein sequence according to NP_853547.1 Features and Benefits Evaluate our antibodies with complete peace of mind.
