Immunosupressant peptides

Immunogen The immunogen for anti-NPS antibody: synthetic peptide derected towards the N terminal of human NPS Sequence Synthetic peptide located within the following region: LILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFL Physical form

General description Anti-NRIP2 Antibody detects endogenous levels of total NRIP2 protein. Immunogen The antiserum was produced against synthesized peptide derived from human NRIP2.

Immunogen NSA1 antibody was raised against a 18 amino acid peptide near the amino terminus of human NSA1. Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Peptide with sequence CPNLGNGADLPNYR, from the internal region of the protein sequence according to NP_006591.1.

Immunogen Nudel antibody was raised against a peptide corresponding to 15 amino acids near the amino terminus of human Nudel. Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen The immunogen for anti-NUDT16 antibody: synthetic peptide derected towards the N terminal of human NUDT16 Sequence Synthetic peptide located within the following region: VLMQMRFDGRLGFPGGFVDAQDSCLEDGLNRELREELGEAMSAFRVERSD Physical

Immunogen synthetic peptide corresponding to amino acids 261-275 of human NUF2 Physical form Solution in 0.01 M phosphate buffered saline, pH 7.

Immunogen a 14 amino acid peptide from near the carboxy-terminus of human NUP160. Linkage The action of this antibody can be blocked using blocking peptide SBP4707 .

Immunogen Synthetic peptide directed towards the N terminal region of human OAS1 Biochem/physiol Actions This protein is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The

Immunogen Synthetic peptide directed towards the middle region of human OCA2 Biochem/physiol Actions OCA2 is believed to be an integral membrane protein involved in small molecule transport, specifically tyrosine - a precursor of melanin.

Immunogen The immunogen for anti-OFD1 antibody: synthetic peptide derected towards the N terminal of human OFD1 Sequence Synthetic peptide located within the following region: AQSTMPHKCDDVLSQDELRKKLYQTFKDRGILDTLKTQLRNQLVHELMHP Physical form

Immunogen Synthetic peptide directed towards the middle region of human OGFOD1 Sequence Synthetic peptide located within the following region: GCEGWEPEYGGFTSYIAKGEDEELLTVNPESNSLALVYRDRETLKFVKHI Physical form Purified antibody supplied in 1x