Immunosupressant peptides

General description This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar

General description Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube (By similarity).

Immunogen OMD (NP_005005.1, 1 a.

Immunogen Synthetic peptide directed towards the middle region of human ONECUT2 Sequence Synthetic peptide located within the following region: LQEPEFQRMSALRLAACKRKEQEPNKDRNNSQKKSRLVFTDLQRRTLFAI Physical form Purified antibody supplied in 1x

Immunogen a 20 amino acid peptide from near the carboxy-terminus of human op18. Linkage The action of this antibody can be blocked using blocking peptide SBP4235 .

Immunogen The immunogen for anti-OPN1MW antibody: synthetic peptide derected towards the C terminal of human OPN1MW Sequence Synthetic peptide located within the following region: CYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVFAYCLCWGPYTFF Physical

General description Anti-OPN4 Antibody detects endogenous levels of total OPN4 protein. Immunogen The antiserum was produced against synthesized peptide derived from human OPN4.

Immunogen Synthetic 16 amino acid peptide from C-terminus of human OPN5. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Dog, Bovine, Elephant, Horse, Rabbit (100%): Gibbon, Mouse (94%): Bat (81%).

Immunogen Peptide with sequence PAYLRDIDGMNKP, from the C-terminal region of the protein sequence according to NP_000903.2 Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Synthetic peptide directed towards the C terminal region of human OR1D2 Sequence Synthetic peptide located within the following region: LHTYSVKDSVATVMYAVVTPMMNPFIYSLRNKDMHGALGRLLDKHFKRLT Physical form Purified antibody supplied in

General description Anti-OR1D4 Antibody detects endogenous levels of total OR1D4 protein. Immunogen The antiserum was produced against synthesized peptide derived from human OR1D4/5.

Immunogen Synthetic peptide directed towards the C terminal region of human OR1G1 Sequence Synthetic peptide located within the following region: FSSPSTHSAQKDTVASVMYTVVTPMLNPFIYSLRNQEIKSSLRKLIWVRK Physical form Purified antibody supplied in