-
Add to Cart The item has been addedSAB2501847-100UGANTI-PAPD5 ANTIBODY PRODUCED IN GOAT (C15-1741-931)
Price: $1,062.79List Price: $1,180.87Immunogen Peptide with sequence C-TDEVATYRDWISKQ, from the internal region of the protein sequence according toNP_001035374.2: NP_001035375. -
Add to Cart The item has been addedSAB2501846-100UGANTI-PAPD5 ANTIBODY PRODUCED IN GOAT (C15-1741-932)
Price: $1,062.79List Price: $1,180.87Immunogen Peptide with sequence C-HALPAEQRDFLP, from the internal region of the protein sequence according toNP_001035374.2: NP_001035375. -
Add to Cart The item has been addedSAB2107001-100ULANTI-PAQR4 (C15-1744-082)
Price: $963.62List Price: $1,070.69Immunogen The immunogen for anti-PAQR4 antibody: synthetic peptide derected towards the C terminal of human PAQR4 Sequence Synthetic peptide located within the following region: ACRPWLRPAALMGYTALSGVAGWRALTAPSTSARLRAFGWQAGARLLVFG Physical form -
Add to Cart The item has been addedSAB2104087-100ULANTI-PARP12 (C15-1744-642)
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the middle region of human PARP12 Sequence Synthetic peptide located within the following region: FYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSL Physical form Purified antibody supplied in 1x -
Add to Cart The item has been addedSAB2101727-100ULANTI-PAX1
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the middle region of human PAX1 Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Immunohistochemistry (1 paper) -
Add to Cart The item has been addedSAB2108455-100ULANTI-PAX2 (C15-1743-722)
Price: $785.86List Price: $873.18Immunogen Synthetic peptide directed towards the middle region of human PAX2 Sequence Synthetic peptide located within the following region: VSSASNDPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDS Physical form Purified antibody supplied in 1x PBS -
Add to Cart The item has been addedSAB2108385-100ULANTI-PAX7 (C15-1743-743)
Price: $963.62List Price: $1,070.69Immunogen Synthetic peptide directed towards the middle region of human Pax7 Sequence Synthetic peptide located within the following region: SDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTREELAQ Physical form Purified antibody supplied in 1x PBS -
Add to Cart The item has been addedSAB2104057-100ULANTI-PCCB (C15-1744-654)
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the middle region of human PCCB Sequence Synthetic peptide located within the following region: PGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSS Physical form Purified antibody supplied in 1x PBS -
Add to Cart The item has been addedSAB4301749-100ULANTI-PCDHA6 (C15-1738-207)
Price: $688.57List Price: $765.07Immunogen Synthetic peptide of human PCDHA6 Features and Benefits Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. -
Add to Cart The item has been addedSAB2108318-100ULANTI-PCOLCE (C15-1743-772)
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the middle region of human PCOLCE Sequence Synthetic peptide located within the following region: LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS Physical form Purified antibody supplied in 1x -
Add to Cart The item has been addedSAB2103722-100ULANTI-PCSK4 (C15-1744-716)
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the N terminal region of human PCSK4 Sequence Synthetic peptide located within the following region: VSSWAVQVSQGNREVERLARKFGFVNLGPIFPDGQYFHLRHRGVVQQSLT Physical form Purified antibody supplied in -
Add to Cart The item has been addedSAB2108699-100ULANTI-PCSK6 (C15-1743-589)
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the N terminal region of human PCSK6 Sequence Synthetic peptide located within the following region: NYDSYASYDVNGNDYDPSPRYDASNENKHGTRCAGEVAASANNSYCIVGI Physical form Purified antibody supplied in
