Immunosupressant peptides

Specificity This antibody reacts to human PD-1 (Programmed cell death protein 1) (CD279). Immunogen A peptide corresponding to the N-terminus of human PD-1.

Specificity This antibody reacts to human PD-1 (Programmed cell death protein 1) (CD279). Immunogen A peptide corresponding to the N-terminus of human PD-1.

Immunogen a 16 amino acid peptide from near the center of human PD-1. Linkage The action of this antibody can be blocked using blocking peptide SBP4067 .

Immunogen Peptide with sequence C-EGKASHREMTSK, from the internal region of the protein sequence according to NP_055271.2: NP_663314.

Immunogen PDCD5 antibody was raised against a 21 amino acid peptide from near the carboxy terminus of human PDCD5. Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Peptide with sequence C-NSFKESMEKSSYSD from the internal region of the protein sequence according to NP_058649.3 : NP_001070665.

Immunogen PDE4A (NP_006193.1, 1 a.

Immunogen Synthetic peptide directed towards the N terminal of human PDE4B Sequence Synthetic peptide located within the following region: LVNKSIRQRRRFTVAHTCFDVENGPSPGRSPLDPQAGSSSGLVLHAAFPG Physical form Purified antibody supplied in 1x PBS

General description Anti-PDE4D Antibody detects endogenous levels of total PDE4D protein. Immunogen The antiserum was produced against synthesized peptide derived from human PDE4D.

Immunogen Synthetic peptide directed towards the N terminal region of human PDE9A Biochem/physiol Actions Phosphodiesterase 9A (PDE9A) is a high-affinity, cGMP-specific enzyme. It belongs to an important protein family that catalyzes the hydrolysis

Immunogen Synthetic peptide directed towards the middle region of human PDIA4 Sequence Synthetic peptide located within the following region: TAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYA Physical form Purified antibody supplied in 1x

General description Anti-PDK1 Antibody detects endogenous levels of total PDK1 protein. Immunogen The antiserum was produced against synthesized peptide derived from human PDK1.