Immunosupressant peptides

General description Anti-PDK1 Antibody detects endogenous levels of total PDK1 protein. Immunogen The antiserum was produced against synthesized peptide derived from human PDK1.

Specificity The antibody detects endogenous levels of total PDP1 protein. Immunogen Fusion protein corresponding to residues near the C terminal of human pyruvate dehyrogenase phosphatase catalytic subunit 1 Features and Benefits Evaluate our

Immunogen The immunogen for anti-PDX1 antibody: synthetic peptide derected towards the N terminal of human PDX1 Biochem/physiol Actions Pdx1 activates insulin and somatostatin gene transcription. It is a key regulator of islet peptide hormone

Immunogen Peptide with sequence C-DPDAPSRKDPKYRE from the internal region of the protein sequence according to NP_002558.1.

Specificity Rat PECAM-1. Antibody gives positive reaction at high dilutions against recombinant rat PECAM-1, confirming specificity.

Immunogen Peptide with sequence C-YKDSSKQDESH, from the internal region of the protein sequence according to NP_001002927.1 Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen A synthesized peptide derived from human PERP Physical form Buffer: PBS with 0.02% sodium azide,0.

Immunogen Synthetic peptide directed towards the N terminal region of human PEX5 Sequence Synthetic peptide located within the following region: TATDRWYDEYHPEEDLQHTASDFVAKVDDPKLANSEFLKFVRQIGEGQVS Physical form Purified antibody supplied in 1x

General description Anti-PFDN1 Antibody detects endogenous levels of total PFDN1 protein. Immunogen The antiserum was produced against synthesized peptide derived from human PFDN1.

General description PFDN6 binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. It also binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for

Immunogen Peptide with sequence C-EPSRPSPQPKPRTP, from the C-terminal region of the protein sequence according to NP_003302.1 Features and Benefits Evaluate our antibodies with complete peace of mind.

General description KLH-conjugated linear peptide corresponding to 10 amino acids surrounding phosphoserine 746 from the C-terminal region of human Exonuclease 1. Application Epitope: C-terminus Quality Evaluated by Dot Blot with peptide