-
Add to Cart The item has been addedHPA015613-100ULANTI-CDH4 (C005B-204207)
Price: $959.88List Price: $1,066.53Immunogen Cadherin-4 precursor recombinant protein epitope signature tag (PrEST) Sequence YLIDINDNAPELLPKEAQICERPNLNAINITAADADVDPNIGPYVFELPFVPAAVRKNWTITRLNGDYAQLSLRILYLEAGMYDVPIIVTDSGNPPLSNTSIIKVKVCPCD Application All Prestige Antibodies Powered by -
Add to Cart The item has been addedHPA007047-100ULANTI-CDH6 (C005B-202734)
Price: $959.88List Price: $1,066.53Immunogen Cadherin-6 precursor recombinant protein epitope signature tag (PrEST) Application Anti-CDH6 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested -
Add to Cart The item has been addedHPA036819-100ULANTI-CDHR1 (C005B-210117)
Price: $1,013.20List Price: $1,125.78Immunogen cadherin-related family member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA012569-100ULANTI-CDHR2 (C005B-203664)
Price: $959.88List Price: $1,066.53Immunogen Protocadherin-24 precursor recombinant protein epitope signature tag (PrEST) Application Anti-CDHR2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is -
Add to Cart The item has been added05-596ANTI-CDK2 ANTIBODY CLONE AN4.3
Price: $878.44List Price: $976.05Specificity cdk2, does not react with other cdks Immunogen Recombinant human cdk2 Application 0.5-2μ:g/ml of this lot detected cdk2 in HeLa nuclear extract. -
Add to Cart The item has been addedHPA046529-100ULANTI-CDK5RAP2 (C005B-214288)
Price: $1,013.20List Price: $1,125.78Immunogen CDK5 regulatory subunit associated protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA035821-100ULANTI-CDK5RAP2 ANTIBODY PRODUCED IN RABBIT (C005B-209605)
Price: $1,066.53List Price: $1,185.03Immunogen CDK5 regulatory subunit associated protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedSAB5702771-100ULANTI-CDK8 ANTIBODY CLONE 7L5X2 RABBIT MONOCLONAL
Price: $727.80List Price: $808.67ANTI-CDK8 ANTIBODY CLONE 7L5X2 RABBIT MONOCLONAL -
Add to Cart The item has been addedSAB5700918-100ULANTI-CDK9 ANTIBODY PRODUCED IN RABBIT (C005B-475343)
Price: $758.66List Price: $842.95General description The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of S. -
Add to Cart The item has been addedAMAB91832-100ULANTI-CDKN1A ANTIBODY PRODUCED IN MOUSE (C005B-255721)
Price: $1,023.49List Price: $1,137.21Immunogen Cyclin dependent kinase inhibitor 1a Application All Prestige Antibodies ®: Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry -
Add to Cart The item has been addedHPA047838-100ULANTI-CDKN2A (C005B-214755)
Price: $1,013.20List Price: $1,125.78Immunogen cyclin-dependent kinase inhibitor 2A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA041397-100ULANTI-CDKN2AIP (C005B-212151)
Price: $1,013.20List Price: $1,125.78Immunogen CDKN2A interacting protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
