-
Add to Cart The item has been addedZRB2278-4X25ULANTI-CNBP CLONE 1I17 ZOOMAB« RABBIT MONOCLONAL (C005B-260671)
Price: $860.71List Price: $956.34General description ZooMAb ®: antibodies represent an entirely new generation of recombinant monoclonal antibodies. Each ZooMAb ®: antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and -
Add to Cart The item has been addedZRB2278-25ULANTI-CNBP CLONE 1I17 ZOOMAB« RABBIT MONOCLONAL (C005B-260672)
Price: $443.44List Price: $492.71General description ZooMAb ®: antibodies represent an entirely new generation of recombinant monoclonal antibodies. Each ZooMAb ®: antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and -
Add to Cart The item has been addedHPA036898-100ULANTI-CNDP2 ANTIBODY PRODUCED IN RABBIT (C005B-210153)
Price: $1,013.20List Price: $1,125.78Immunogen CNDP dipeptidase 2 (metallopeptidase M20 family) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA036899-100ULANTI-CNDP2 ANTIBODY PRODUCED IN RABBIT (C005B-210154)
Price: $1,013.20List Price: $1,125.78Immunogen CNDP dipeptidase 2 (metallopeptidase M20 family) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA049378-100ULANTI-CNGA3 (C005B-215298)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to cyclic nucleotide gated channel alpha 3 Sequence FLLRRWAARHVHHQDQGPDSFPDRFRGAELKEVSSQESNAQANVGSQEPADRGRSAWPLAKCNTNTSNNTEEEK Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
Add to Cart The item has been addedHPA002544-100ULANTI-CNIH1 ANTIBODY PRODUCED IN RABBIT
Price: $959.88List Price: $1,066.53Cornichon (CNIH) is expressed in a wide range of human tissues with different expression levels. It is found abundantly in the heart, liver, skeletal muscle, pancreas, adrenal medulla and cortex, thyroid, testis, spleen, appendix, peripheral blood -
Add to Cart The item has been addedHPA044268-100ULANTI-CNIH4 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen cornichon homolog 4 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA049095-100ULANTI-CNN2 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen calponin 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA035614-100ULANTI-CNOT10 (C005B-209516)
Price: $1,013.20List Price: $1,125.78Immunogen CCR4-NOT transcription complex, subunit 10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA041450-100ULANTI-CNOT10 (C005B-212182)
Price: $1,013.20List Price: $1,125.78Immunogen CCR4-NOT transcription complex, subunit 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA069823-100ULANTI-CNOT11 (C005B-220989)
Price: $1,013.20List Price: $1,125.78Immunogen CCR4-NOT transcription complex, subunit 11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA067711-100ULANTI-CNOT2 (C005B-220604)
Price: $1,013.20List Price: $1,125.78Immunogen CCR4-NOT transcription complex, subunit 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
