-
Add to Cart The item has been addedHPA044568-100ULANTI-CNOT6 (C005B-213629)
Price: $1,013.20List Price: $1,125.78Immunogen CCR4-NOT transcription complex, subunit 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA069543-100ULANTI-CNOT7 (C005B-220927)
Price: $1,013.20List Price: $1,125.78Immunogen CCR4-NOT transcription complex, subunit 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA023266-100ULANTI-CNP (C005B-206050)
Price: $959.88List Price: $1,066.53CNP (2′,3′-cyclic nucleotide 3′ phosphodiesterase) is highly expressed in brain and is used as a marker for oligodendrocytes. It is a member of the 2H phosphoesterase superfamily. -
Add to Cart The item has been addedHPA023278-100ULANTI-CNP (C005B-206056)
Price: $959.88List Price: $1,066.53CNP (2′,3′-cyclic nucleotide 3′ phosphodiesterase) is highly expressed in brain and is used as a marker for oligodendrocytes. It is a member of the 2H phosphoesterase superfamily. -
Add to Cart The item has been addedHPA023280-100ULANTI-CNP (C005B-206058)
Price: $959.88List Price: $1,066.53CNP (2′,3′-cyclic nucleotide 3′ phosphodiesterase) is highly expressed in brain and is used as a marker for oligodendrocytes. It is a member of the 2H phosphoesterase superfamily. -
Add to Cart The item has been addedHPA023338-100ULANTI-CNP (C005B-206088)
Price: $959.88List Price: $1,066.53CNP (2′,3′-cyclic nucleotide 3′ phosphodiesterase) is highly expressed in brain and is used as a marker for oligodendrocytes. It is a member of the 2H phosphoesterase superfamily. -
Add to Cart The item has been addedSAB5702133-100ULANTI-CNPASE ANTIBODY CLONE 8O3B6 RABBIT MONOCLONAL
Price: $727.80List Price: $808.67ANTI-CNPASE ANTIBODY CLONE 8O3B6 RABBIT MONOCLONAL -
Add to Cart The item has been addedHPA038465-100ULANTI-CNPY2 ANTIBODY PRODUCED IN RABBIT (C005B-210787)
Price: $1,013.20List Price: $1,125.78Immunogen canopy 2 homolog (zebrafish) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA038466-100ULANTI-CNPY2 (C005B-210788)
Price: $1,013.20List Price: $1,125.78Immunogen canopy 2 homolog (zebrafish) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA001397-100ULANTI-CNTN2 (C005B-201356)
Price: $959.88List Price: $1,066.53Immunogen Contactin-2 precursor recombinant protein epitope signature tag (PrEST) Sequence PASPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTPTLHLTGKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVENMAVRPAPHPGTVISHSVAMLIL Application All -
Add to Cart The item has been addedHPA039492-100ULANTI-CNTN5 (C005B-211270)
Price: $1,013.20List Price: $1,125.78Immunogen contactin 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA041223-100ULANTI-CNTN5 (C005B-212070)
Price: $1,013.20List Price: $1,125.78Immunogen contactin 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
