-
Add to Cart The item has been addedHPA048158-100ULANTI-COX17 ANTIBODY PRODUCED IN RABBIT (C005B-214872)
Price: $1,013.20List Price: $1,125.78Immunogen COX17 cytochrome c oxidase assembly homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA046772-100ULANTI-COX18 ANTIBODY PRODUCED IN RABBIT (C005B-214397)
Price: $1,013.20List Price: $1,125.78Immunogen COX18 cytochrome c oxidase assembly homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA049489-100ULANTI-COX18 ANTIBODY PRODUCED IN RABBIT (C005B-215356)
Price: $1,013.20List Price: $1,125.78Immunogen COX18 cytochrome c oxidase assembly homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA014295-100ULANTI-COX6C ANTIBODY PRODUCED IN RABBIT
Price: $959.88List Price: $1,066.53Immunogen cytochrome c oxidase subunit VIc Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA021836-100ULANTI-CPA1 (C005B-205758)
Price: $959.88List Price: $1,066.53Immunogen Carboxypeptidase A1 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA031330-100ULANTI-CPAMD8 (C005B-208686)
Price: $970.54List Price: $1,078.38Immunogen C3 and PZP-like, alpha-2-macroglobulin domain containing 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA055465-100ULANTI-CPD (C005B-217347)
Price: $1,013.20List Price: $1,125.78Immunogen carboxypeptidase D Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedSAB1407150-50UGANTI-CPEB3 (C005B-335493)
Price: $980.46List Price: $1,089.40Immunogen CPEB3 (AAH36444.1, 1 a. -
Add to Cart The item has been addedHPA002657-100ULANTI-CPM (C005B-201685)
Price: $1,118.92List Price: $1,243.24CPM (carboxypeptidase M) is an extracellular glycosylphosphatidylinositol (GPI) anchored membrane glycoprotein. It belongs to the regulatory or CPN/E subfamily of zinc metallocarboxypeptidases. -
Add to Cart The item has been addedHPA004732-100ULANTI-CPN2 (C005B-202246)
Price: $959.88List Price: $1,066.53CPN2 is a large tetrameric extracellular glycoprotein with molecular mass of 280kDa. It belongs to the CPN/E subfamily of regulatory metallo-carboxypeptidases."" -
Add to Cart The item has been addedHPA078300-100ULANTI-CPNE4 (C005B-222358)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to copine 4 Sequence AEVPNQVVDYYNGKGIKPKCSSEMYESSRTLAP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA031636-100ULANTI-CPNE6 (C005B-208816)
Price: $970.54List Price: $1,078.38Immunogen copine VI (neuronal) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by
