-
Add to Cart The item has been addedHPA024621-100ULANTI-ADAM2 (C005B-206529)
Price: $959.88List Price: $1,066.53The gene ADAM2 (disintegrin and metalloproteinase domain-containing protein 2) is mapped to human chromosome 8p11. It belongs to the ADAM family of proteins. -
Add to Cart The item has been addedHPA026581-100ULANTI-ADAM2 (C005B-206807)
Price: $959.88List Price: $1,066.53The gene ADAM2 (disintegrin and metalloproteinase domain-containing protein 2) is mapped to human chromosome 8p11. It belongs to the ADAM family of proteins. -
Add to Cart The item has been addedHPA044156-100ULANTI-ADAM32 (C005B-213494)
Price: $1,013.20List Price: $1,125.78Immunogen ADAM metallopeptidase domain 32 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA040223-100ULANTI-ADAMTS10 (C005B-211603)
Price: $1,013.20List Price: $1,125.78Immunogen ADAM metallopeptidase with thrombospondin type 1 motif, 10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA035973-100ULANTI-ADAMTS12 (C005B-209699)
Price: $1,013.20List Price: $1,125.78Immunogen ADAM metallopeptidase with thrombospondin type 1 motif, 12 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA075079-100ULANTI-ADAMTS12 (C005B-221885)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to ADAM metallopeptidase with thrombospondin type 1 motif 12 Sequence SYIMEKRYGNLSHVKMMASSAPLCHLSGTVLQQGTRVGTAALSACHGLTGFFQLPHGDFFIEPVKKHPLVEGGYHPHIVYRRQKVPETK Application All Prestige Antibodies Powered -
Add to Cart The item has been addedHPA042014-100ULANTI-ADAMTS13 ANTIBODY PRODUCED IN RABBIT (C005B-212484)
Price: $1,013.20List Price: $1,125.78Immunogen ADAM metallopeptidase with thrombospondin type 1 motif, 13 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA042844-100ULANTI-ADAMTS13 ANTIBODY PRODUCED IN RABBIT (C005B-212867)
Price: $1,013.20List Price: $1,125.78Immunogen ADAM metallopeptidase with thrombospondin type 1 motif, 13 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA052077-100ULANTI-ADAMTS13 ANTIBODY PRODUCED IN RABBIT (C005B-216253)
Price: $1,066.53List Price: $1,185.03Immunogen ADAM metallopeptidase with thrombospondin type 1 motif 13 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA042867-100ULANTI-ADAMTS15 (C005B-212874)
Price: $1,013.20List Price: $1,125.78Immunogen ADAM metallopeptidase with thrombospondin type 1 motif, 15 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA067668-100ULANTI-ADAMTS16 ANTIBODY PRODUCED IN RABBIT
Price: $1,066.53List Price: $1,185.03Immunogen ADAM metallopeptidase with thrombospondin type 1 motif 16 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA044326-100ULANTI-ADAMTS18 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen ADAM metallopeptidase with thrombospondin type 1 motif, 18 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)
