Infliximab

Anti-FCER1A Fc fragment of IgE, high affinity I, receptor fo

Anti-FCER1A Fc fragment of IgE, high affinity I, receptor fo

ANTI-FGF1 ANTIBODY CLONE 3X3E5 RABBIT MONOCLONAL

Polyclonal antibody for IL 1 BETA/IL1B detection. Host: Rabbit.

IL27RA (also known as Interleukin-27 receptor subunit alpha, Cytokine receptor WSX-1, Cytokine receptor-like 1, Type I T-cell cytokine receptor, TCCR and ZcytoR1) is a receptor for IL27 and requires IL6ST/gp130 to mediate signal transduction in

Infliximab with the brand name of Remicade, is a chimeric monoclonal IgG1 antibody. It binds to TNF-&alpha, which is a key proinflammatory cytokine involved in chronic inflammatory diseases.

General description INHBE is a member of the activin beta family (see INHBA: MIM 147290) that plays a role in pancreatic exocrine cell growth and proliferation (Hashimoto et al., 2006 [PubMed 16426570]).

General description INHBE is a member of the activin beta family (see INHBA: MIM 147290) that plays a role in pancreatic exocrine cell growth and proliferation (Hashimoto et al., 2006 [PubMed 16426570]).

ANTI-INI-1 (MRQ-27)

Interleukin-1 beta (UniProt also known as IL-1 beta, IL-1b, IL-1beta) is encoded by the Il1b gene (Gene ID 16176) in murine species. Interleukin-1 (IL-1) is a cytokine that plays a central role in the regulation of acute and chronic inflammation.

Interleukin-1 beta (UniProt also known as IL-1 beta, IL-1b, IL-1beta) is encoded by the Il1b gene (Gene ID 16176) in murine species. Interleukin-1 (IL-1) is a cytokine that plays a central role in the regulation of acute and chronic inflammation.

Immunogen The immunogen for anti-RFFL antibody: synthetic peptide derected towards the N terminal of human RFFL Sequence Synthetic peptide located within the following region: MWASCCNWFCLDGQPEEAPPPQGARTQAYSNPGYSSFPSPTGSEPSCKAC Physical form