-
Add to Cart The item has been added618-109-007Anti-FERRET IgM (mu chain) (GOAT) Antibody Texas Red Conjugated, 1mg, Lyophilized
Price: $368.05List Price: $408.95This product is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. This product is also suitable for multiplex analysis, including multicolor imaging, utilizing various commercial -
Add to Cart The item has been addedSAB4500946-100UGANTI-FLI1 ANTIBODY PRODUCED IN RABBIT (C005B-324446)
Price: $946.78List Price: $1,051.98General description Anti-FLI1 Antibody detects endogenous levels of total FLI1 protein. Immunogen The antiserum was produced against synthesized peptide derived from human FLI1. -
Add to Cart The item has been addedSAB2104978-100ULANTI-FLJ14213 (C005B-476275)
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the middle region of human FLJ14213 Sequence Synthetic peptide located within the following region: LNYASPITAVSRPLNEMVLTPLTEQEGEAYLEKCGSVRRHTVANAHSDIQ Physical form Purified antibody supplied in 1x -
Add to Cart The item has been addedSAB2900166-50UGANTI-FLT3 ANTIBODY PRODUCED IN RABBIT (C005B-328225)
Price: $1,315.38List Price: $1,461.54Immunogen Synthetic 20 amino acid peptide from internal region of human FLT3 / CD135. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%): Marmoset, Rabbit (95%): Hamster (85%): Bovine, Dog, Panda, Horse -
Add to Cart The item has been addedSAB1407148-50UGANTI-FRMPD1 (C005B-335495)
Price: $980.46List Price: $1,089.40Immunogen FRMPD1 (NP_055722.1, 1 a. -
Add to Cart The item has been addedSAB4501050-100UGANTI-FYN ANTIBODY PRODUCED IN RABBIT (C005B-324390)
Price: $946.78List Price: $1,051.98General description Anti-FYN Antibody detects endogenous levels of total FYN protein. Immunogen The antiserum was produced against synthesized peptide derived from human Fyn. -
Add to Cart The item has been added06-896ANTI-GFP (GREEN FLUORESCENT PROTEIN) ANTIBODY
Price: $1,105.32List Price: $1,228.13General description Green fluorescent protein (GFP) is a 29 kDa fluorescent protein isolated from the jellyfish Aequorea victoria. Upon exposure to blue light (488 nm), GFP strongly fluoresces (Emission max: 507 nm). -
Add to Cart The item has been addedSAB1410028-50UGANTI-GINS1 ANTIBODY PRODUCED IN MOUSE
Price: $980.46List Price: $1,089.40General description The yeast heterotetrameric GINS complex is made up of Sld5 (GINS4: MIM 610611), Psf1, Psf2 (GINS2: MIM 610609), and Psf3 (GINS3: MIM 610610). The formation of the GINS complex is essential for the initiation of DNA replication -
Add to Cart The item has been added209-403-B97Anti-Human MIP-1 (RABBIT) Antibody Peroxidase Conjugated, 100 g, Lyophilized
Price: $921.53List Price: $1,023.92This protein-A purified antibody has been tested for use in ELISA and western blotting. Specific conditions for reactivity should be optimized by the end user. -
Add to Cart The item has been added209-401-B97Anti-Human MIP-1 (RABBIT) Antibody, 100 g, Lyophilized
Price: $962.05List Price: $1,068.95This purified antibody has been tested for use in ELISA and western blotting. Reactivity is also expected in neutralizations, radioimmunoassay and immunohistochemistry. The endotoxin content is estimated to be -
Add to Cart The item has been added209-306-B51Anti-Human MIP-3a (MOUSE) Biotin Conjugated Monoclonal Antibody, 100 g, Lyophilized
Price: $908.42List Price: $1,009.36Anti-Human MIP-3a antibody has been tested for use in ELISA, IP, and Neutralization. Specific conditions for reactivity should be optimized by the end user. -
Add to Cart The item has been added209-301-B51Anti-Human MIP-3a (MOUSE) Monoclonal Antibody, 100 g, Liquid (sterile filtered)
Price: $891.04List Price: $990.04Anti-Human MIP-3a antibody has been tested for use in ELISA, IP, and Neutralization. Specific conditions for reactivity should be optimized by the end user.
