-
Add to Cart The item has been addedZRB2004-25ULANTI-RAB9A CLONE 1B16 ZOOMAB« RABBIT MONOCLONAL (C005B-480942)
Price: $443.44List Price: $492.71ANTI-RAB9A CLONE 1B16 ZOOMAB« RABBIT MONOCLONAL -
Add to Cart The item has been addedZRB2004-4X25ULANTI-RAB9A CLONE 1B16 ZOOMAB« RABBIT MONOCLONAL (C005B-480943)
Price: $860.71List Price: $956.34ANTI-RAB9A CLONE 1B16 ZOOMAB« RABBIT MONOCLONAL -
Add to Cart The item has been addedSAB5702988-100ULANTI-RNF20 ANTIBODY CLONE 8N4O8 RABBIT MONOCLONAL
Price: $727.80List Price: $808.67ANTI-RNF20 ANTIBODY CLONE 8N4O8 RABBIT MONOCLONAL -
Add to Cart The item has been addedSAB2900343-50UGANTI-RNF25 ANTIBODY PRODUCED IN RABBIT (C005B-328181)
Price: $1,315.38List Price: $1,461.54Immunogen Synthetic peptide from human RNF25. Features and Benefits Evaluate our antibodies with complete peace of mind. -
Add to Cart The item has been addedSAB5702689-100ULANTI-RNF40 ANTIBODY CLONE 8I7R5 RABBIT MONOCLONAL
Price: $727.80List Price: $808.67ANTI-RNF40 ANTIBODY CLONE 8I7R5 RABBIT MONOCLONAL -
Add to Cart The item has been addedSAB2102034-100ULANTI-RNF5 (C005B-476379)
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the N terminal region of human RNF5 Sequence Synthetic peptide located within the following region: AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCL Physical form Purified antibody supplied in 1x -
Add to Cart The item has been addedMABC603ANTI-SERPINB5 CLONE 5C6.2
Price: $829.44List Price: $921.60General description Serpin B5 (UniProt P36952: also known as Maspin, Peptidase inhibitor 5, PI-5) is encoded by the SERPINB5 (also known as PI5) gene (Gene ID 5268) in human. Serpin B5/Maspin is an evolutionarily conserved serine protease -
Add to Cart The item has been addedMABE1128ANTI-SETBP1 CLONE 63
Price: $751.40List Price: $834.89General description SET-binding protein (UniProt Q9Y6X0: also known as SEB, SETBP1) is encoded by the SETBP1 (also known as KIAA0437, MRD29) gene (Gene ID 26040) in human. SETBP1 is shown to bind the SET nuclear oncogene involved in DNA -
Add to Cart The item has been addedZRB2758-25ULANTI-SGLT-1 CLONE 1K16 ZOOMAB« RABBIT MONOCLONAL (C005B-481356)
Price: $443.44List Price: $492.71ANTI-SGLT-1 CLONE 1K16 ZOOMAB« RABBIT MONOCLONAL -
Add to Cart The item has been addedZRB2758-4X25ULANTI-SGLT-1 CLONE 1K16 ZOOMAB« RABBIT MONOCLONAL (C005B-481357)
Price: $860.71List Price: $956.34ANTI-SGLT-1 CLONE 1K16 ZOOMAB« RABBIT MONOCLONAL -
Add to Cart The item has been addedSAB1304513-400ULANTI-SIGNAL PEPTIDE PEPTIDASE-LIKE 2B (SPPL2B) (N-TERM)
Price: $900.00List Price: $1,000.00Physical form Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. -
Add to Cart The item has been addedZRB2787-25ULANTI-SLC31A1/CTR1 CLONE 1K21 ZOOMAB« RABBIT MONOCLONAL (C005B-481386)
Price: $443.44List Price: $492.71ANTI-SLC31A1/CTR1 CLONE 1K21 ZOOMAB« RABBIT MONOCLONAL
