-
Add to Cart The item has been addedHPA035863-100Anti-AP1AR adaptor-related protein complex 1 associated reg Latory protein, 100 L (C003B-079679)
Price: $1,108.10List Price: $1,231.23Anti-AP1AR adaptor-related protein complex 1 associated regu -
Add to Cart The item has been addedHPA058115-100Anti-AP1AR adaptor-related protein complex 1 associated reg Latory protein, 100 L (C003B-087603)
Price: $1,108.10List Price: $1,231.23Anti-AP1AR adaptor-related protein complex 1 associated regu -
Add to Cart The item has been addedHPA000956-100ULANTI-APEX1 (C005B-201219)
Price: $959.88List Price: $1,066.53Immunogen APEX nuclease (multifunctional DNA repair enzyme) 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedSAB4301037-100ULANTI-APMAP ANTIBODY PRODUCED IN RABBIT
Price: $688.57List Price: $765.07Specificity The antibody detects endogenous levels of total APMAP protein. Immunogen Synthetic peptide corresponding to residues near the N terminal of human adipocyte plasma membrane associated protein Features and Benefits Evaluate our -
Add to Cart The item has been addedHPA017957-100ULANTI-APOBEC2 (C005B-204660)
Price: $959.88List Price: $1,066.53Apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 (APOBEC2) has a molecular weight of 25kDa. It is expressed as a rod-shaped tetramer having 224 amino acids and the gene encoding it is localized on chromosome 6p21. -
Add to Cart The item has been addedHPA055116-100ULANTI-APOBEC3D ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen apolipoprotein B mRNA editing enzyme catalytic subunit 3D recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA021492-100ULANTI-APOBEC3H ANTIBODY PRODUCED IN RABBIT (C005B-205642)
Price: $959.88List Price: $1,066.53Immunogen apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedHPA015636-100ULANTI-APOBEC4 (C005B-204217)
Price: $959.88List Price: $1,066.53Immunogen Putative C->U-editing enzyme APOBEC-4 recombinant protein epitope signature tag (PrEST) Sequence YEEYLANHGTIVKPYYWLSFSLDCSNCPYHIRTGEEARVSLTEFCQIFGFPYGTTFPQTKHLTFYELKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIILYSNNSPCNEANHC -
Add to Cart The item has been addedSAB2700764-100ULANTI-APOD ANTIBODY PRODUCED IN RABBIT (C005B-476083)
Price: $928.07List Price: $1,031.19Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 189 of Apolipoprotein D according to NP_001638 Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, -
Add to Cart The item has been addedHPA049797-100ULANTI-APOL4 ANTIBODY PRODUCED IN RABBIT (C005B-215450)
Price: $1,013.20List Price: $1,125.78Immunogen apolipoprotein L, 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA040968-100ULANTI-APOL5 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen apolipoprotein L, 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA018152-100ULANTI-ARFGAP2 (C005B-204736)
Price: $959.88List Price: $1,066.53The gene ADP-ribosylation factor GTPase-activating protein-2 (ARFGAP2) has been mapped to human chromosome 11p11.2.
