Tuberculin purified protein derivative

Apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 (APOBEC2) has a molecular weight of 25kDa. It is expressed as a rod-shaped tetramer having 224 amino acids and the gene encoding it is localized on chromosome 6p21.

Immunogen apolipoprotein B mRNA editing enzyme catalytic subunit 3D recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen Putative C-&gtU-editing enzyme APOBEC-4 recombinant protein epitope signature tag (PrEST) Sequence YEEYLANHGTIVKPYYWLSFSLDCSNCPYHIRTGEEARVSLTEFCQIFGFPYGTTFPQTKHLTFYELKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIILYSNNSPCNEANHC

Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 189 of Apolipoprotein D according to NP_001638 Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers,

Immunogen apolipoprotein L, 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen apolipoprotein L, 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

The gene ADP-ribosylation factor GTPase-activating protein-2 (ARFGAP2) has been mapped to human chromosome 11p11.2.

Specificity The antibody detects endogenous levels of total ARID1A protein. Immunogen Synthetic peptide corresponding to a region derived from internal residues of human AT rich interactive domain 1A (SWI-like) Features and Benefits Evaluate

ARID5B (AT rich interactive domain 5B) belongs to the family of DNA-binding proteins called AT-rich interaction domain (ARID). This gene is localized to human chromosome 10q21.

Immunogen ADP-ribosylation factor-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

The actin-related protein Arp1&#945 (centractin, actin-RPV), a member of the superfamily of actin-related proteins (Arp), is the major subunit of the dynactin complex, a key component of the cytoplasmic dynein motor machinery. It has been shown to