Ustekinumab

Immunogen copper chaperone for superoxide dismutase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen copper chaperone for superoxide dismutase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

CD276 (cluster of differentiation 276) is a member of the B7 family of T cell co-regulatory molecules, which functions as an immune-regulatory molecule. This protein is inducible by inflammatory cytokines on T-cells, B-cells and dendritic cells.

General description The RPA-T4 antibody reacts with human CD4, a 59 kDa protein which acts as a co-receptor for the T cell receptor (TCR) in its interaction with MHC Class II molecules on antigen-presenting cells. The extracellular domain of CD4

Immunogen Cd5 molecule Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Cd5 molecule Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen CD99 molecule recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

CUB-domain-containing protein 1 (CDCP1) is a type I transmembrane protein which functions as a substrate for Src kinases. It has a molecular weight of 140kDa, and has a proteolytically cleaved form of molecular weight 85kDa.

General description CDH15 (cadherin 15) is a member of the transmembrane glycoprotein adhesion-mediating protein family called cadherins. CDH15 is also known as MCAD or muscle-cadherin.

Immunogen Recombinant protein corresponding to cadherin related family member 4 Sequence ATLDYKLWFRSSSNPASLCLYDRVLEVNATLDCDTPGACFQHAASILVLDGGQPQMTTEVPVLVMVTPINEFSPACAPRTFRVQE Application All Prestige Antibodies Powered by Atlas Antibodies are

The WDR16 (WD repeat domain 16) protein has 11 conserved WD40 (&#946-transducin)-repeat domains. It is mainly expressed in the testis.

The gene CHADL (chondroadherin like) is mapped to human chromosome 22. It encodes a small leucine-rich protein.