Ustekinumab

Chondroadherin-like protein (CHADL) is a leucine-rich protein which is expressed in cartilaginous tissues, specifically in fetal cartilage and in the pericellular space of adult chondrocytes. Immunogen Chondroadherin-like protein precursor

Immunogen Recombinant protein corresponding to checkpoint with forkhead and ring finger domains Sequence AYLIQHPDKSRSEEDVQSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSDISQPYVVCRQCPEYRR Application All Prestige Antibodies Powered by Atlas Antibodies

Immunogen Recombinant protein corresponding to choroideremia-like (Rab escort protein 2). Sequence VEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRNRITYSQIVKEGRRFNIDLVS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen Recombinant protein corresponding to choroideremia-like (Rab escort protein 2). Sequence LEVTDVEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRNRITY Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen glycosyltransferase 25 domain containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen glycosyltransferase 25 domain containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen coenzyme Q7 homolog, ubiquinone (yeast) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen cAMP responsive element binding protein 3-like 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen cellular repressor of E1A-stimulated genes 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

The gene CSDE1 (cold shock domain-containing protein E1) is mapped to human chromosome 1p. CSDE1 is also called as UNR (N-ras upstream gene).

Cutaneous T-cell lymphoma-associated antigen 5 is a protein encoded by the CTAGE5 gene in humans and is mapped to human chromosome 14q. The previously assigned protein identifier O15320 has been merged into Q96PC5.

Immunogen Hepatoma-derived growth factor-related protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as