-
Add to Cart The item has been addedHPA037878-100ULANTI-DNMBP (C005B-210491)
Price: $1,013.20List Price: $1,125.78Immunogen dynamin binding protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA026588-100ULANTI-DNMT3A (C005B-206811)
Price: $959.88List Price: $1,066.53Immunogen DNA recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA029675-100ULANTI-DNPH1 (C005B-208007)
Price: $959.88List Price: $1,066.53Immunogen Deoxyribonucleoside 5'-monophosphate N-glycosidase (EC 3.2. -
Add to Cart The item has been addedHPA029676-100ULANTI-DNPH1 (C005B-208008)
Price: $959.88List Price: $1,066.53Immunogen Deoxyribonucleoside 5'-monophosphate N-glycosidase (EC 3.2. -
Add to Cart The item has been addedHPA066571-100ULANTI-DOK2
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to docking protein 2 Sequence RPDHIYDEPEGVAALSLYDSPQEPRGEAWRRQATADRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKGPK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
Add to Cart The item has been addedHPA054460-100ULANTI-DOK5 (C005B-217021)
Price: $1,013.20List Price: $1,125.78Immunogen docking protein 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA068706-100ULANTI-DOLK (C005B-220765)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to dolichol kinase Sequence YQNAKRSSSESKKHQAPTIARKY Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA019179-100ULANTI-DOLPP1 (C005B-205022)
Price: $959.88List Price: $1,066.53DOLPP1 (dolichyldiphosphatase 1) is widely expressed in mouse tissues. The protein localizes to the endoplasmic reticulum. -
Add to Cart The item has been added600-401-AX0Anti-DPAGT1 (RABBIT) Antibody, 100 g, Liquid (sterile filtered)
Price: $962.05List Price: $1,068.95Anti-DPAGT1 Antibody has been tested for use in ELISA, Western Blotting, Immunohistochemistry and Immunofluorescence. Specific conditions for reactivity should be optimized by the end user. -
Add to Cart The item has been addedHPA020880-100ULANTI-DPF2 (C005B-205447)
Price: $959.88List Price: $1,066.53DPF2 (D4, zinc and double PHD fingers family 2) belongs to the d4-protein family. The protein contains an amino-terminal 2/3 domain, a C2H2-type zinc finger and a carboxyl-terminal PHD (plant homeodomain) zinc finger. -
Add to Cart The item has been addedHPA076234-100ULANTI-DPH5 (C005B-222062)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to diphthamide biosynthesis 5. Sequence VLRATKLGIPYRVIHNASIMNAVGCCGLQLYKFGETVSIVFWTDTWRPESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRKIYEPPRYMS Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA043682-100ULANTI-DPRX ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen divergent-paired related homeobox recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
