Ustekinumab

Immunogen F-box and WD repeat domain containing 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

General description F-box/WD repeat-containing protein 7 (Fbxw7) is part of an ubiquitin-protein ligase complex. The complex ubiquitinates and degrades several important oncogenes such as mTOR, MYC, AURKA, JUN, and NOTCH1.

Immunogen F-box and WD repeat domain containing 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Recombinant protein corresponding to fibroblast growth factor 11 Sequence VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Fibroblast growth factor 3 (FGF3) is expressed in mesenchymal tissues and the gene encoding this protein is present on chromosome 11q13. Immunogen INT-2 proto-oncogene protein precursor recombinant protein epitope signature tag (PrEST) Application

Immunogen fibroblast growth factor binding protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen fibroblast growth factor receptor 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

The gene FK506 binding protein 14 (FKBP14) is mapped to human chromosome 7p15.1.

Anti-FKBP15 FK506 binding protein 15, 133kDa, 25ul UN 1687 6

Anti-FKBP1A FK506 binding protein 1A, 12kDa, 100ul UN 1687 6

Immunogen Recombinant protein corresponding to FK506 binding protein 1B Sequence RIGKQEVIKGFEEGAAQLGPLSPLPI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen FK506-binding protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported