Ustekinumab

LHX9 (LIM homeobox 9) is a transcription factor belonging to a family of developmental regulators. It is expressed in the brain of mouse embryos, with predominant expression in diencephalon, telencephalic vesicles, and dorsal mesencephalon.

Immunogen LIM domain only 2 (rhombotin-like 1) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

LNX1 (ligand of numb-protein X 1) is the PDZ (PSD95, Dlg1, and zo-1) domain-containing member of the RING (really interesting new gene) finger-type E3 ubiquitin ligase family. It participates in tumorigenesis.

The gene LONRF1 (LON peptidase N-terminal domain and ring finger 1) is mapped to human chromosome 8p. It can be induced by androgens.

The gene LONRF1 (LON peptidase N-terminal domain and ring finger 1) is mapped to human chromosome 8p. It can be induced by androgens.

Immunogen LON peptidase N-terminal domain and ring finger 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Lysophosphatidic acid receptor 5 (LPA receptor 5) (LPA-5) (G-protein coupled receptor 92) (G-protein coupled receptor 93) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen leucine-rich repeat, immunoglobulin-like and transmembrane domains 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen Recombinant protein corresponding to leucine rich repeat containing 27 Sequence NRKVPLNPPGKMKPSKEKSPQASKEMSALQERNLEEKIKQHVLQMREQRRFHGQAPLEEMRKAAEDLEIATELQDEVLKLKLGL Application All Prestige Antibodies Powered by Atlas Antibodies are

The gene LRRC45 (leucine rich repeat containing 45) encodes a 72kDa protein that contains several N-terminal leucine-rich repeat (LRR) domains and a long coiled-coil domain at the C terminus. It is localized at the proximal ends of the mother and

The gene LRRC45 (leucine rich repeat containing 45) encodes a 72kDa protein that contains several N-terminal leucine-rich repeat (LRR) domains and a long coiled-coil domain at the C terminus. It is localized at the proximal ends of the mother and

LRRFIP1 (Leucine rich repeat (in FLII) interacting protein 1) is a cytoplasmic protein with binding capacity of dsRNA, GC-rich Z-form dsDNA and AT-rich B-form dsDNA. It consists of an N-terminal domain, coiled coil domain for the the leucine-rich