-
Add to Cart The item has been addedHPA072906-100ULANTI-MTMR11 ANTIBODY PRODUCED IN RABBIT (C005B-221500)
Price: $1,066.53List Price: $1,185.03Immunogen myotubularin related protein 11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA034515-100ULANTI-MTMR3 (C005B-209037)
Price: $970.54List Price: $1,078.38Immunogen myotubularin related protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA034516-100ULANTI-MTMR3 (C005B-209038)
Price: $970.54List Price: $1,078.38Immunogen myotubularin related protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA020464-100ULANTI-MUM1L1 (C005B-205377)
Price: $959.88List Price: $1,066.53Mutated melanoma-associated antigen 1-like protein 1 (MUM1L1) can exist in four splice variants. It possesses a mutated melanoma-associated antigen 1 domain. -
Add to Cart The item has been addedHPA041885-100ULANTI-MVB12A (C005B-212414)
Price: $1,013.20List Price: $1,125.78Immunogen family with sequence similarity 125, member A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA042231-100ULANTI-MVB12A (C005B-212596)
Price: $1,013.20List Price: $1,125.78Immunogen family with sequence similarity 125, member A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA002738-100ULANTI-NAB1 (C005B-201703)
Price: $959.88List Price: $1,066.53NAB1 (NGFI-A binding protein 1) is a nuclear protein, copiously expressed in all human cell lines. It acts as a transcriptional corepressor. -
Add to Cart The item has been addedHPA064931-100ULANTI-NAIF1 (C005B-220025)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to nuclear apoptosis inducing factor 1 Sequence EQQNDLLQMIRRSQEVQACAQERQAQAMEGTQAALSVLIQVLRPMIKDFRRYLQSNTANPAPASDPGQVAQNGQPDSIIQ Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA042438-100ULANTI-NAIP (C005B-212673)
Price: $1,013.20List Price: $1,125.78Immunogen NLR family, apoptosis inhibitory protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA021918-100ULANTI-NAT16 (C005B-205775)
Price: $959.88List Price: $1,066.53Immunogen Putative N-acetyltransferase C7orf52 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedSAB4300338-100UGANTI-NBN (AB-343) ANTIBODY PRODUCED IN RABBIT
Price: $825.16List Price: $916.84Immunogen Peptide sequence around aa. 341-345 (S-L-S-Q-G), according to the protein NBN. -
Add to Cart The item has been addedHPA051747-100ULANTI-NBPF11 ANTIBODY PRODUCED IN RABBIT (C005B-216126)
Price: $1,013.20List Price: $1,125.78Immunogen neuroblastoma breakpoint family, member 11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
