Ustekinumab

Immunogen Recombinant protein corresponding to paired like homeobox 2a Sequence AAELLKAWQPAESGPGPFSGVLSSFHRKPGPALKTNLF Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen Recombinant protein corresponding to paired like homeobox 2b Sequence MEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSLTPGSCSLGTLRDHQS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen E3 ubiquitin-protein ligase Praja1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen praja ring finger 2, E3 ubiquitin protein ligase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Polycystin 2 (PKD2), a transient receptor potential (TRP) cation channel, comprises six transmembrane domains and is present in the arteries, especially of the mesentery and cerebrum. It belongs to the TRP ion channel subfamily.

Immunogen polycystic kidney and hepatic disease 1 (autosomal recessive) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Pyruvate kinase L/R (PKLR) gene is mapped to human chromosome 1q22. This gene codes for two isoforms pyruvate kinase L (PKL) and pyruvate kinase R (PKR), which are exclusively expressed in liver and red blood cells, respectively.

ANTI-PKR/EIF2AK2 ANTIBODY CLONE 5B7B6 RABBIT MONOCLONAL

Immunogen pleckstrin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Pleckstrin homology domain-containing family A member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

PLEKHA2 (pleckstrin homology domain containing, family A, phosphoinositide binding specific member 2) is a signal transduction adaptor protein. It is expressed in wide range of tissues including lymphoid tissues.