Lymphatic mapping probes

Apex2 (apurinic/apyrimidinic endodeoxyribonuclease 2) is located in the nucleus and also to some extent to the mitochondria. It belongs to the novel AP endonuclease family with a mitochondrial targeting sequence (MTS) and proliferating cell nuclear

The gene CEP57 (centrosomal protein of 57kDa) is mapped to human chromosome 11q21. CEP57 is a centrosomal protein and is localized to the central spindle and midbody.

Chromatin target of PRMT1 (CHTOP) is localized to nuclear speckles and possesses a RG-rich domain. The protein is composed of 248 amino acids.

Immunogen Recombinant protein corresponding to EF-hand domain family member B Sequence KVIPVGYRVATCLTEKLPRLITPPEAKKYFNFRYPPAGVERVFYGRANDPQIAPYLTHGIRSKISILANTLINPQPITTFQQKIKDKKESIYLSNRRAPL Application All Prestige Antibodies Powered by Atlas

FAR1 (Fatty acyl CoA reductase 1) is abundantly expressed in the preputial gland and at lower levels in many other organs and cells. Immunogen Fatty acyl-CoA reductase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige

General description Forkhead box protein G1 (FOXG1) is also called Brain factor 1 (BF-1), Brain factor 2 (BF-2), Forkhead-related protein FKHL1 (HFK1), Forkhead-related protein FKHL2 (HFK2) and Forkhead-related protein FKHL3 (HFK3). FOXG1 is a

Heterogeneous nuclear ribonucleoprotein R (HNRNPR) contains two RNA recognition motifs-RRM1 and RRM2. The gene encoding it is localized on human chromosome 1p36.

Immunogen Recombinant protein corresponding to leucine rich repeat containing 46 Sequence LDLSENLIETLKLDEFPQSLLILNLSGNSCTNQDGYRELVTEALPLLLDLDGQPVVERWISDEEDEASSDEEFPELSGPFCSERGFLKELEQE Application All Prestige Antibodies Powered by Atlas Antibodies

General description The protein named U6 snRNA-associated Sm-like protein LSm1 or Cancer associated Sm-like, or Small nuclear ribonuclear CaSm and encoded by the human gene LSM1/CASM is a critical binding protein that mediates replication

General description Liver X receptor &#945: and &#946: (LXR-&#945:/LXR-&#946:) are members of LXRs that belong to the nuclear receptor superfamily. LXR-&#945: is expressed predominantly in macrophages, liver, intestine, kidney, lung and adipose

General description The gene LXR &#945: (liver X receptor &#945:) is a member of LXRs that belong to the nuclear receptor superfamily. The encoded protein is expressed predominantly in macrophages, liver, intestine, kidney, lung and adipose tissue.

MISP (mitotic spindle positioning) is an actin-binding protein, that belongs to the A-kinase anchoring proteins (AKAP) family. It is also known as C19ORF21.