-
Add to Cart The item has been addedA9171-.5MLAnti-Chicken IgY (IgG) (whole molecule)-Alkaline Phosphatase antibody produced in rabbit (C15-1315-512)
Price: $416.94List Price: $463.27Immunoglobulin Y (IgY) is also known as egg yolk immunoglobulin and is found mainly in birds, amphibians and reptiles. IgY cannot activate mammalian complement system and cannot bind to mammalian rheumatoid factors, and protein A or G. -
Add to Cart The item has been addedA9171-1MLAnti-Chicken IgY (IgG) (whole molecule)-Alkaline Phosphatase antibody produced in rabbit (C15-1315-513)
Price: $541.71List Price: $601.90Immunoglobulin Y (IgY) is also known as egg yolk immunoglobulin and is found mainly in birds, amphibians and reptiles. IgY cannot activate mammalian complement system and cannot bind to mammalian rheumatoid factors, and protein A or G. -
Add to Cart The item has been addedHPA054381-25ULANTI-CHRNA5
Price: $540.00List Price: $600.00Immunogen cholinergic receptor, nicotinic, alpha 5 (neuronal) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
Add to Cart The item has been addedABS1645Anti-Chromatin-Modifying Protein 6 (C15-1317-758)
Price: $687.43List Price: $763.81Charged multivesicular body protein 6 (UniProt: Q96FZ7 also known as Chromatin-modifying protein 6, Vacuolar protein sorting-associated protein 20, Vps20, hVps20, CHMP6) is encoded by the CHMP6 (also known as VPS20) gene (Gene ID: 79643) in human. -
Add to Cart The item has been addedAB1280Anti-Cytochrome P450 Enzyme CYP4A1/2/3 Antibody (C15-1315-696)
Price: $804.00List Price: $893.33Specificity Binds specifically to cytochrome P450 CYP4A1, CYP4A2 and CYP4A3 in rat hepatic microsomal fraction. Immunogen Synthetic peptide Application Anti-Cytochrome P450 Enzyme CYP4A1/2/3 Antibody is an antibody against Cytochrome P450 Enzyme -
Add to Cart The item has been addedABE1408Anti-DNA polymerase beta Antibody (C15-1316-917)
Price: $666.86List Price: $740.95DNA polymerase beta (EC 2.7. -
Add to Cart The item has been addedABC462Anti-DNA polymerase subunit gamma-1 Antibody/POLG (C15-1316-724)
Price: $804.00List Price: $893.33POLG is a mitochondrial protein that plays a major role in mitochondrial DNA replication and only for mitochondrial DNA. POLG is the catalytic subunit of a multiple protein complex that makes up the holo-enzyme that is the mitochondrial specific -
Add to Cart The item has been addedHPA076261-100ULAnti-DNAH17
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to dynein axonemal heavy chain 17 Sequence PWKDYVIYIDDMVLDEFDQFIRKSLSFLMDNMVIDESIAPLFEIRMELDEDGLTFNPTLEVGSDRGFLALIEGLVNDIYNVARLIPRLAKDRMNYKMD Application All Prestige Antibodies Powered by Atlas -
Add to Cart The item has been addedHPA010642-25ULANTI-DNAJB12
Price: $540.00List Price: $600.00DNAJ/HSP40 family of proteins contains a highly conserved, 70 amino acid J domain that is involved in the interaction with HSP70 and regulation of its ATPase activity. It also contains a glycine and phenylalanine (G/F)-rich region that may function -
Add to Cart The item has been addedA0793-1MLAnti-Dog IgG (whole molecule)-Alkaline Phosphatase antibody produced in rabbit (C15-1314-842)
Price: $853.71List Price: $948.57An immunoglobulin has two heavy chain and two light chain connected by disulfide bond. It mainly helps in immune defense. -
Add to Cart The item has been addedABE2863Anti-E3 ubiquitin-protein ligase (UBR5/EDD) (C15-1317-079)
Price: $666.86List Price: $740.95E3 ubiquitin-protein ligase UBR5 (UniProt: O95071 also known as EC:2.3. -
Add to Cart The item has been addedABE2863-25ULAnti-E3 ubiquitin-protein ligase (UBR5/EDD) (C15-1317-080)
Price: $323.27List Price: $359.18E3 ubiquitin-protein ligase UBR5 (UniProt: O95071 also known as EC:2.3.
