Molecular Biology

Specificity Recognizes Glutamate Receptor 1 [GluR1], phosphoSer831. The antibody recognizes a protein of ~100 kDa corresponding to GluR1 phosphorylated at Ser831 in rat hippocampal homogenate.

Glutamate receptor 1 (AMPA) belongs to the glutamate-gated ion channel and binds AMPA, glutamate and kainate. L-Glutamate is the major excitatory neurotransmitter in the mammalian CNS, acting through both ligand gated ion channels (ionotropic

Glutamate receptor 1 (AMPA) belongs to the glutamate-gated ion channel and binds AMPA, glutamate and kainate. L-Glutamate is the major excitatory neurotransmitter in the mammalian CNS, acting through both ligand gated ion channels (ionotropic

G-protein coupled receptor 3 (GPR3) is a member of the G-protein coupled receptor 1 family that constitutively activates adenylate cyclase and is highly expressed in the central nervous system. Overexpression of GPR3 stimulates the production of

Immunogen Synthetic peptide directed towards the middle region of human GPR161 Biochem/physiol Actions GPR161 is Orphan receptor. Sequence Synthetic peptide located within the following region: FLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSG

Immunogen Probable G-protein coupled receptor 161 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen G protein-coupled receptor 161 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

GPR18 (G-protein-coupled receptor 18) encodes a seven transmembrane G-protein-linked receptor that is highly expressed in testis and spleen. Its expression is strongest in hypothalamus, thyroid, peripheral blood leucocytes, cerebellum and brain

The gene GPR182 (G-protein coupled receptor 182) is mapped to human chromosome 2q13.3.

The gene GPR19 (G protein-coupled receptor 19) encodes a receptor having sequence similarity with the D2 dopamine and neuropeptide Y families of receptors. The gene is mapped to human chromosome 12.

Immunogen G protein-coupled receptor 26 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Probable G-protein coupled receptor 34 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,