Molecular Biology

Protein C is a Vitamin K-dependent plasma zymogen that is activated by proteolytic cleavage of the thrombin-thrombomodulin complex to form an anticoagulant enzyme. Anti-Protein C mouse monoclonal antibody (clone HPC4) binds specifically to an

Receptor-type tyrosine-protein phosphatase zeta (UniProt: Q62656 also known as EC:3.1.

Receptor-type tyrosine-protein phosphatase zeta (UniProt: Q62656 also known as EC:3.1.

Ras-related protein 1 GTPase activating protein 2 (RAP1GAP2) gene with 26 exons spanning 261 kilobases of genomic DNA, is mapped to human chromosome 17p13.3.

An immunoglobulin has two heavy chains and two lights chain connected by disulfide bond. It mainly helps in immune defense.

An immunoglobulin has two heavy chains and two lights chain connected by disulfide bond. It mainly helps in immune defense.

E3 ubiquitin-protein ligase RNF213 (UniProt: Q63HN8 also known as ALK lymphoma oligomerization partner on chromosome 17, Mysterin, RING finger protein 213, RING-type E3 ubiquitin transferase RNF21) is encoded by the RNF213 (also known as ALO17,

E3 ubiquitin-protein ligase RNF213 (UniProt: Q63HN8 also known as ALK lymphoma oligomerization partner on chromosome 17, Mysterin, RING finger protein 213, RING-type E3 ubiquitin transferase RNF21) is encoded by the RNF213 (also known as ALO17,

Immunogen Recombinant protein corresponding to receptor interacting serine/threonine kinase 4 Sequence SGKRLSGVSSVDSAFSSRGSLSLSFEREPSTSDLGTTDVQKKKLVDAIVSGDTSKLMKILQPQDVDLALD Application All Prestige Antibodies Powered by Atlas Antibodies are

DNA-directed RNA polymerase II subunit RPB1 (EC 2.7.

RNA polymerase II subunit B1 (RPB1) is the largest subunit of the RNA polymerase II complex. As a holoenzyme RNA polymerase II catalyzes transcription of eukaryotic DNA into RNA using the four ribonucleoside triphosphates as substrates.

Immunogen Recombinant protein corresponding to ribonuclease A family member 12 (inactive) Sequence DEAVMSTLEHLHVDYPQNDVPVPARYCNHMIIQRVIREPDHTCKKEHVFIHERPR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated