Molecular Biology Kits

Anti-FAM114A1 family with sequence similarity 114, member A1

Anti-FAM214B family with sequence similarity 214, member B,

Anti-FAM214B family with sequence similarity 214, member B,

Free fatty acid receptor 2 (FFAR2), also known as G-protein coupled receptor 43 (GPR43), functions as the cell membrane receptor for short chain fatty acids that ultimately stimulates G protein coupled, inhibitory (Gi) signals via the adenylate

Forkhead box protein K2 (UniProt: Q01167 also known as Cellular transcription factor ILF-1, FOXK1, Interleukin enhancer-binding factor 1) is encoded by the FOXK2 (also known as ILF, ILF1) gene (Gene ID: 3607) in human. Forkhead box protein K2 is a

Immunogen Recombinant protein corresponding to GIPC PDZ domain containing family, member 1. Sequence MPLGLGRRKKAPPLVENEEAEPGRG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

G-protein coupled receptor 3 (GPR3) is a member of the G-protein coupled receptor 1 family that constitutively activates adenylate cyclase and is highly expressed in the central nervous system. Overexpression of GPR3 stimulates the production of

Anti-GPR15 G protein-coupled receptor 15, 100ul UN 1687 6.1

Anti-GPR15 G protein-coupled receptor 15, 25ul UN 1687 6.1 P

Immunogen Synthetic peptide directed towards the middle region of human GPR161 Biochem/physiol Actions GPR161 is Orphan receptor. Sequence Synthetic peptide located within the following region: FLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSG

Immunogen Probable G-protein coupled receptor 161 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen G protein-coupled receptor 161 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in