-
-
-
-
-
-
-
-
-
Add to Cart The item has been addedABC299Anti-FFAR2 Antibody/GPR43 (C15-1316-687)
Price: $804.00List Price: $893.33Free fatty acid receptor 2 (FFAR2), also known as G-protein coupled receptor 43 (GPR43), functions as the cell membrane receptor for short chain fatty acids that ultimately stimulates G protein coupled, inhibitory (Gi) signals via the adenylate -
Add to Cart The item has been addedHPA061786-100ULAnti-GIPC1
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to GIPC PDZ domain containing family, member 1. Sequence MPLGLGRRKKAPPLVENEEAEPGRG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedABN473Anti-GPR Antibody3 (C15-1317-610)
Price: $804.00List Price: $893.33G-protein coupled receptor 3 (GPR3) is a member of the G-protein coupled receptor 1 family that constitutively activates adenylate cyclase and is highly expressed in the central nervous system. Overexpression of GPR3 stimulates the production of -
Add to Cart The item has been addedAV42354-100ULAnti-GPR161 antibody produced in rabbit (C15-1341-390)
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the middle region of human GPR161 Biochem/physiol Actions GPR161 is Orphan receptor. Sequence Synthetic peptide located within the following region: FLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSG
