Molecular Biology Reagents

An alpha-aminoaralkylphosphonic acid ester that acts as an aminopeptidase N/CD13 inhibitor (IC 50 =1.1 &#181M).

An acetyl-L-arginine analog of TAME that serves as a negative control. TAME is an ubiquitin ligase inhibitor that specifically blocks Anaphase-Promoting Complex (APC) activation.

TAME is a potent ubiquitin ligase inhibitor that specifically blocks Anaphase-Promoting Complex (APC) activation by directly binding to APC and disrupts the IR-tail-dependent interactions between APC and its activator proteins Cdc20 or Cdh1. It

A cell-permeable N-acetylated, C-hydroxamate derivative of a 14-mer peptide designed from the MEK-2 template that acts as a competitive inhibitor of Anthrax lethal factor (LF) metalloprotease (K i = 1 nM). Also inhibits MEK-3 cleavage.

60S ribosomal protein L26 (UniProt: P61254) is encoded by the RPL26 gene (Gene ID: 6154) in human. 60S ribosomal protein L26 belongs to the ribosomal protein L24P family and is found in all eukaryotes.

60S ribosomal protein L26 (UniProt: P61254) is encoded by the RPL26 gene (Gene ID: 6154) in human. 60S ribosomal protein L26 belongs to the ribosomal protein L24P family and is found in all eukaryotes.

A disintegrin and metalloproteinase domain-containing protein 9 (ADAM 9) belongs to a family of transmembrane, membrane-anchored, disintegrin-containing proteins that are involved in several biological functions such as protein ectodomain shedding,

Glucosylceramidase (EC 3.2.

Immunogen Synthetic peptide directed towards the C terminal region of human CDK8 Application Anti-CDK8 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 &#956g/ml.

Immunogen cholinergic receptor, nicotinic, alpha 5 (neuronal) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Charged multivesicular body protein 6 (UniProt: Q96FZ7 also known as Chromatin-modifying protein 6, Vacuolar protein sorting-associated protein 20, Vps20, hVps20, CHMP6) is encoded by the CHMP6 (also known as VPS20) gene (Gene ID: 79643) in human.

Immunogen Recombinant protein corresponding to dynein axonemal heavy chain 17 Sequence PWKDYVIYIDDMVLDEFDQFIRKSLSFLMDNMVIDESIAPLFEIRMELDEDGLTFNPTLEVGSDRGFLALIEGLVNDIYNVARLIPRLAKDRMNYKMD Application All Prestige Antibodies Powered by Atlas