Molecular Biology Reagents

Included Positive Antigen Control: Catalog # 12-302, EGF-stimulated A431 cell lysate Product Description: Produced from CHO cells expressing the 4G10 antibody heavy and light chain cDNAs. Heavy chain C-terminus has a hexa-histidine tag for

Plakophilin 2 (Pkp2) is an armadillo-repeat protein of the cardiac desmosome. The armadillo-repeat proteins contain ten 42–amino acid armadillo-repeat motifs.

Immunogen plakophilin 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen polo-like kinase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Serine/threonine-protein kinase PLK1 (UniProt: P53350 also known as EC: 2.7.

Receptor-type tyrosine-protein phosphatase zeta (UniProt: Q62656 also known as EC:3.1.

Receptor-type tyrosine-protein phosphatase zeta (UniProt: Q62656 also known as EC:3.1.

Ras-related protein 1 GTPase activating protein 2 (RAP1GAP2) gene with 26 exons spanning 261 kilobases of genomic DNA, is mapped to human chromosome 17p13.3.

E3 ubiquitin-protein ligase RNF213 (UniProt: Q63HN8 also known as ALK lymphoma oligomerization partner on chromosome 17, Mysterin, RING finger protein 213, RING-type E3 ubiquitin transferase RNF21) is encoded by the RNF213 (also known as ALO17,

E3 ubiquitin-protein ligase RNF213 (UniProt: Q63HN8 also known as ALK lymphoma oligomerization partner on chromosome 17, Mysterin, RING finger protein 213, RING-type E3 ubiquitin transferase RNF21) is encoded by the RNF213 (also known as ALO17,

Immunogen Recombinant protein corresponding to receptor interacting serine/threonine kinase 4 Sequence SGKRLSGVSSVDSAFSSRGSLSLSFEREPSTSDLGTTDVQKKKLVDAIVSGDTSKLMKILQPQDVDLALD Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen Recombinant protein corresponding to ribonuclease A family member 12 (inactive) Sequence DEAVMSTLEHLHVDYPQNDVPVPARYCNHMIIQRVIREPDHTCKKEHVFIHERPR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated