DNA Synthesis Inhibitors

Charged multivesicular body protein 6 (UniProt: Q96FZ7 also known as Chromatin-modifying protein 6, Vacuolar protein sorting-associated protein 20, Vps20, hVps20, CHMP6) is encoded by the CHMP6 (also known as VPS20) gene (Gene ID: 79643) in human.

Immunogen Recombinant protein corresponding to dynein axonemal heavy chain 17 Sequence PWKDYVIYIDDMVLDEFDQFIRKSLSFLMDNMVIDESIAPLFEIRMELDEDGLTFNPTLEVGSDRGFLALIEGLVNDIYNVARLIPRLAKDRMNYKMD Application All Prestige Antibodies Powered by Atlas

C1 Inhibitor is a member of the serpin family of structurally related proteins, and is the primary regulator of the immune complement system. C1 Inhibitor is a protease inhibitor that functions to inhibit the complement system in order to prevent

A cell-permeable, potent, specific, and nontoxic inhibitor of the DNA repair enzyme, APE1 (human apurinic/apyrimidinic endonuclease IC 50 = ~3 &#181M). Shown to target the APE1 active site and inhibit its 3&#8242-phosphodiesterase and

Aflatoxins are mycotoxins found in foods and livestock feeds that were initially produced by species of Aspergillus. Aflatoxin M1 is the hydroxylated metabolite of aflatoxin B1 it inhibits DNA synthesis and induces cell cycle arrest.