Kinase Inhibitors

Anti-MAP3K14 mitogen-activated protein kinase kinase kinase

NFKBIB is a NF-&#954B inhibitor that forms a complex with NF-&#954B and traps it in the cytoplasm. Serine phosphorylation in NFKBIB proteins activates its ubiquitin-mediated degradation.

Plakophilin 2 (Pkp2) is an armadillo-repeat protein of the cardiac desmosome. The armadillo-repeat proteins contain ten 42–amino acid armadillo-repeat motifs.

Immunogen plakophilin 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Anti-PLK1 polo-like kinase 1, 100ul UN 1687 6.1 PG2

Anti-PLK1 polo-like kinase 1, 25ul UN 1687 6.1 PG2

Immunogen polo-like kinase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Anti-PLK3 polo-like kinase 3, 100ul UN 1687 6.1 PG2

Anti-PLK3 polo-like kinase 3, 25ul UN 1687 6.1 PG2

Serine/threonine-protein kinase PLK1 (UniProt: P53350 also known as EC: 2.7.

Immunogen Recombinant protein corresponding to receptor interacting serine/threonine kinase 4 Sequence SGKRLSGVSSVDSAFSSRGSLSLSFEREPSTSDLGTTDVQKKKLVDAIVSGDTSKLMKILQPQDVDLALD Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen Serine protease inhibitor Kazal-type 4 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as