Ribonuclease Inhibitors

Application ADP-ribosylcyclase is a Ca 2+ signaling second messenger. It may be used to study calcium signaling and has been used to research morphine antinociception and tolerance .

This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the

60S ribosomal protein L26 (UniProt: P61254) is encoded by the RPL26 gene (Gene ID: 6154) in human. 60S ribosomal protein L26 belongs to the ribosomal protein L24P family and is found in all eukaryotes.

60S ribosomal protein L26 (UniProt: P61254) is encoded by the RPL26 gene (Gene ID: 6154) in human. 60S ribosomal protein L26 belongs to the ribosomal protein L24P family and is found in all eukaryotes.

Anti-ARL13B ADP-ribosylation factor-like 13B, 100ul UN 1687

Anti-ARL13B ADP-ribosylation factor-like 13B, 25ul UN 1687 6

Anti-METTL10 methyltransferase like 10, 100ul UN 1687 6.1 PG

Anti-MRPS6 mitochondrial ribosomal protein S6, 100ul UN 1687

Anti-MRPS6 mitochondrial ribosomal protein S6, 25ul UN 1687

Immunogen Recombinant protein corresponding to ribonuclease A family member 12 (inactive) Sequence DEAVMSTLEHLHVDYPQNDVPVPARYCNHMIIQRVIREPDHTCKKEHVFIHERPR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

Anti-SNF2á/BRG1 200 æL

Application Important building block for chiral acyclics, cyclopentenones, and oxabicyclic systems. Also employed in studies on nonlinear optical materials.