General description
This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. (provided by RefSeq)
Immunogen
ADAM2 (NP_001455, 376 a.a. ~ 475 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RLDPFFKQQAVCGNAKLEAGEECDCGTEQDCALIGETCCDIATCRFKAGSNCAEGPCCENCLFMSKERMCRPSFEECDLPEYCNGSSASCPENHYVQTGH
Biochem/physiol Actions
ADAM2 (disintegrin and metalloproteinase domain-containing protein 2) is an integrin binding protein. Absence of ADAM2 in mice causes defects in sperm-egg binding. In addition, it helps in transfer of sperm from the uterus into the oviduct.
Physical form
Solution in phosphate buffered saline, pH 7.4
- UPC:
- 41181829
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- SAB1403842-100UG
- Product Size:
- 100/µG
