MONOCLONAL ANTI-AHR ANTIBODY PRODUCED IN MOUSE (C15-1689-519)

General description

Aryl hydrocarbon receptor (Ahr) is a helix-loop-helix transcription factor and a heterodimeric protein. It is encoded by the gene mapped to human chromosome 7p211. The encoded protein is a member of the helix-loop-helix/Per-Arnt-Sim (bHLH/PAS) family of transcription factors. AHRis mainly expressed in the cytoplasm and is found in a complex with chaperone proteins such as HSP90 (heat shock protein 90), XAP2 (X-associated protein 2 ) and p23 (cochaperone for the Hsp90).

This gene encodes a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Its ligands included a variety of aromatic hydrocarbons. (provided by RefSeq)

Immunogen

AHR (NP_001612, 721 a.a. ~ 820 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINN

Application

Monoclonal Anti-AHR antibody produced in mouse has been used in western blot technique.

Biochem/physiol Actions

Aryl hydrocarbon receptor (Ahr) helps in the inhibitory effects of 2-(4-hydroxy-3-methoxyphenyl)-benzothiazole (YL-109) on development and invasion of MDA-MB-231 (breast adenocarcinoma cell line) by upregulation of heat shock protein 70 (Hsp70)-interacting protein (CHIP). The encoded protein regulates invasiveness and metastasis of breast cancer cells. Ahr mediates various biological responses to extensive environmental pollutants.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.