Monoclonal Anti-APOL3 antibody produced in mouse

Description General description: This gene is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 6. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids, including cholesterol, and/or allow the binding of lipids to organelles. In addition, expression of this gene is up-regulated by tumor necrosis factor-alpha in endothelial cells lining the normal and atherosclerotic iliac artery and aorta. Alternative splicing results in multiple transcript variants. (provided by RefSeq) Immunogen: APOL3 (NP_663615, 240 a.a. ~ 336 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: VEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRG Physical form: Clear solution Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

1. What is the function of the APOL3 gene? The APOL3 gene belongs to the apolipoprotein L family and is involved in lipid transport and binding within the cytoplasm, possibly affecting cholesterol movement and organelle lipid interaction. 2. What was used as the immunogen for this antibody? A partial recombinant APOL3 protein (amino acids 240–336) with a GST tag was used. The GST tag has a molecular weight of 26 kDa. 3. What is the physical form of the product? The antibody is provided as a clear solution. 4. Can this antibody be used for diagnostic or therapeutic applications? No. This product is strictly for research use only and must not be used for diagnostic, therapeutic, or human/animal consumption purposes. 5. Is the APOL3 antibody suitable for studying atherosclerosis? Yes, APOL3 expression is known to be up-regulated by TNF-alpha in endothelial cells of atherosclerotic vessels, making it relevant for vascular inflammation studies.