General description
AT-rich interaction domain 1B (ARID1B) is a member of SWItch/sucrose nonfermentable (SWI/SNF) chromatin remodelling complex. ARID1B gene is located on human chromosome 6q25.3.
Immunogen
ARID1B (NP_059989, 1364 a.a. ~ 1460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNR
Biochem/physiol Actions
AT-rich interaction domain 1B (ARID1B) is involved in the regulation of transcription and multiple downstream cellular processes. ARID1B acts as a coactivator of cell cycle genes. ARID1B acts as tumor suppressor in pancreatic cancer cell line. Mutations in ARID1B might be associated with Coffin-Siris syndrome (CSS).
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51202416
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- WH0057492M1-100UG
- Temperature Control Device:
- Yes
