General description
The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. The SOCS box serves to couple suppressor of cytokine signaling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Multiple alternatively spliced transcript variants have been described for this gene. (provided by RefSeq)
Immunogen
ASB10 (NP_001135931, 48 a.a. ~ 153 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSWSPEECKGQGEPLDDRHPLCARLVEKPSRGSEEHLKSGPGPIVTRTASGPALAFWQAVLAGDVGCVSRILADSSTGLAPDSVFDTSDPERWRDFRFNIRALRLW
Biochem/physiol Actions
ASB10 (ankyrin repeat and SOCS box containing 10) plays a vital role in the ubiquitination-mediated proteasomal and autophagy-lysosomal degradation pathways. The ANK repeat containing domain is responsible for protein-protein interactions whereas the SOCS (suppressor of cytokine signaling) box motif helps in ubiquitination of the protein by binding to the multisubunit E3 ubiquitin ligase complex. ASB family interacts specifically with Cul5-Rbx2 in cells to form an E3 ubiquitin (Ub) ligase complex.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51132231
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- WH0136371M2-100UG
- Temperature Control Device:
- Yes
