General description
ATOH7 is a member of the family of basic helix-loop-helix (bHLH) proteins with similarity to Drosophila ′atonal,′ a proneural bHLH gene that controls photoreceptor development (Brown et al., 2002 [PubMed 11889557]).[supplied by OMIM
Immunogen
ATOH7 (NP_660161, 53 a.a. ~ 99 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEA
Physical form
Solution in phosphate buffered saline, pH 7.4
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 12352200
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- SAB1405386-100UG
- Temperature Control Device:
- Yes