General description
The protein encoded by this gene acts as receptor for arginine vasopressin. This receptor belongs to the subfamily of G-protein coupled receptors which includes AVPR1B, V2R and OXT receptors. Its activity is mediated by G proteins which stimulate a phosphatidylinositol-calcium second messenger system. The receptor mediates cell contraction and proliferation, platelet aggregation, release of coagulation factor and glycogenolysis. (provided by RefSeq)
Immunogen
AVPR1A (NP_000697, 1 a.a. ~ 52 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAK
Physical form
Clear solution
- UPC:
- 51202401
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- SAB1401026-200UL
- Product Size:
- 200/µL
