General description
The brain derived neurotrophic factor (BDNF) gene is mapped to human chromosome 11p14.1.
The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer′s and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene. (provided by RefSeq)
Immunogen
BDNF (AAH29795, 1 a.a. ~ 247 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHMIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYKTKCNPMGYAKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Application
Monoclonal Anti-BDNF antibody produced in mouse has been used in western blotting.
Biochem/physiol Actions
Brain derived neurotrophic factor (BDNF) is involved in hippocampal function and verbal episodic memory in humans. Variation in the BDNF gene expression alters these neurological functions. BDNF also plays a vital role in vascular function and participates in angiogenesis via the specific receptor tropomyosin-related kinase B (TrkB). ProBDNF interacts with the p75 neurotrophin receptor, leading to long-term depression in the hippocampus.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51142037
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- SAB1402127-100UG
- Temperature Control Device:
- Yes
