General description
Chromosome 9 open reading frame 98 (C9orf98) is also referred to as adenylate kinase 8. It possesses two adenylate kinase domains.
Immunogen
C9orf98 (NP_689785, 381 a.a. ~ 479 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PFDSIMERLTLRRIDPVTGERYHLMYKPPPTMEIQARLLQNPKDAEEQVKLKMDLFYRNSADLEQLYGSAITLNGDQDPYTVFEYIESGIINPLPKKIP
Biochem/physiol Actions
Chromosome 9 open reading frame 98 (C9orf98) has a high affinity for adenosine monophosphate (AMP).
Features and Benefits
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 41106500
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- WH0158067M1-100UG
- Temperature Control Device:
- Yes