Immunogen
CHST4 (NP_005760, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LMIDSRIVMGQHEQKLKKEDQPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLARAPVAQTSRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAF
Biochem/physiol Actions
CHST4 (Carbohydrate sulfotransferase 4) is a sulfotransferase which plays a vital role in L-selectin ligand formation in the vascular endothelial cells. It possesses GlcNAc-6-sulfotransferase activity. CHST4 transfers sulfate from 3′-phosphoadenosine 5′ phospho-sulfate to the 6-hydroxyl group of N-acetylglucosamine on glycoproteins.
Physical form
Solution in phosphate buffered saline, pH 7.4
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51411712
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- SAB1402502-100UG
- Temperature Control Device:
- Yes
