General description
CITED4 (Cbp (CREB-binding protein)/p300-interacting transactivator 4) gene is mapped to human chromosome 1p34.2.
Immunogen
CITED4 (NP_597724.1, 131 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GMDAELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPPAGSVSC
Biochem/physiol Actions
CITED4 (Cbp (CREB-binding protein)/p300-interacting transactivator 4) is a transcriptional cofactor. It is found to be downregulated in some of the tumor types including colorectal cancer. It is involved in the regulation of TGFB (transforming growth factor β1), TFAP2 (transcription factor A) and HIF1A (hypoxia inducible factor 1 αsubunit). It prevents the transactivation of HIF1A by inhibiting its binding to p300. CITED4 is known to be involved in the development of neural crest and neural tube.
Features and Benefits
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
Physical form
Solution in phosphate buffered saline, pH 7.4
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 12352200
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- SAB1400832-100UG
- Temperature Control Device:
- Yes
