MONOCLONAL ANTI-CMTM4 (C-TERMINAL)

Catalog No.: C15-1750-887
Mfr. No.: SAB1405367-100UG
Mfr. Name: Sigma-Aldrich
Qty/UOM: 1
UOM: EA

Price: $980.46

List Price: $1,089.40

General description This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor

Enjoy exclusive benefits including discounted pricing on orders by contacting our Sales Executives to open an account. Contact Us

Current Stock:

Quantity:

Adding to cart… The item has been added

Description
Specifications

General description

This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. Alternatively spliced transcript variants encoding different isoforms have been identified. (provided by RefSeq)

Immunogen

CMTM4 (NP_848933, 173 a.a. ~ 234 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQLA

Physical form

Solution in phosphate buffered saline, pH 7.4

Shipping Information:

Dry Ice Surcharge & Ice Pack Shipments: $40

More Information: https://cenmed.com/shipping-returns

UPC:: 51285102
Condition:: New
Availability:: 3-5 Days
Weight:: 1.00 Ounces
HazmatClass:: No
MPN:: SAB1405367-100UG
Temperature Control Device:: Yes

Cenmed Satisfaction Guarantee

At Cenmed, your confidence and satisfaction are paramount. We guarantee the quality and reliability of our extensive range of clinical and laboratory supplies. If you're not completely satisfied with your purchase, we offer a straightforward return process and dedicated support to resolve your concerns promptly. Our commitment ensures that you can order with confidence, knowing that Cenmed is dedicated to superior service and customer satisfaction. Trust us to meet your needs with every order, backed by our promise of excellence. Learn more in Help & FAQs.

"Cenmed provides me access to the same products/services normally reserved for much larger labs than mine. I was presently surprised by their product offering."